DPCstruct | MC32718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3HGT0 | 1-72 | MATQLASCKRADPAELKTIFLKYASIEENGVHYMSAVDFVKRFMAFYDDAEANPNSVQLLASAVHQTKDGQV |
| A0A0L0BLG1 | 261-328 | STDKLREVFQKYATYEKNGEHFMTSEDFVRKFLGLFTDAAFNDESVRLLAGIADTSKDGLISFSEFQA |
| A0A3B5LES2 | 1-72 | None |
| A0A3Q0JBL9 | 48-112 | None |
| A0A671Z2R3 | 14-78 | None |
| A0A226E5P9 | 5-94 | None |
| A0A6P7R5W8 | 1-87 | None |
| A0A1I7ZS08 | 55-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.