DPCstruct | MC32713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 156 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0PHI5 | 145-292 | YHRDIVDYFNSFVMDFCNCLWRNRAFNKQDKNALGCQLSDEIIATLKSMAEMQGIFFGSVFSITHGTVFARWSAETLRDLENASTTI… |
| A0A367J5Q0 | 22-174 | DQPEDHRTEEYLSSFNACMLNVCSALWKTISIQGEQPPFDLPAVTVERLFERCQERGTDVQRALSITQSAALIGFSKRFMKALEEQE… |
| A0A1X0RZ40 | 575-726 | None |
| A0A4T0Q679 | 167-340 | None |
| A0A446BEY6 | 107-262 | None |
| A0A1E4T4J0 | 2-168 | None |
| A0A1L0DV18 | 221-377 | None |
| A0A077WX33 | 514-659 | None |
| A0A0V1Q314 | 453-609 | None |
| A0A1E4S5Y2 | 965-1120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.