DPCstruct | MC32712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 172 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0RPC2 | 20-200 | EFDLNNFVNKDFFVEVFLSLVIRQMCDGSKSVKSTLKNTTTIYRQLIAKHKDSYCNNISYIQPKLPYAQQTALYECTKVQTAYQNNT… |
| A0A367IM04 | 43-217 | RHLDDYLRITNYQRPSFVYAQQSAIIKGTNIYTTYANNVHLRFGQHLQRAVNVLLNTRQRIVDLRRVLSAQGMNDDEIKHRIHQDII… |
| I1BXT0 | 1-182 | None |
| A0A1X0RK42 | 1-171 | None |
| A0A2G4TAF1 | 1-182 | None |
| A0A367KDF6 | 3-161 | None |
| A0A0B7MVA8 | 47-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.