DPCstruct | MC32711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378C851 | 2-83 | DFFRNHDLINEDGDTLSMEDVVLASASNPAHRRNEMMACVKGLELIAEMRGDCAMLYTINCPSKYHATLMNGKPNPTWDHST |
| A0A811DMX3 | 2-81 | QKREQRRKAMDFFRNHDLINEDGDTLSMEDVVLASASNPAHRRNEMMACVKGLELIAEMRGDCAMLYTITCPSKYHVTLM |
| A0A6N8K860 | 49-131 | None |
| A0A0W8JCU3 | 178-263 | None |
| A0A495QHB5 | 189-256 | None |
| Q669M9 | 11-86 | None |
| A0A377YTT3 | 11-94 | None |
| A0A193QG77 | 199-282 | None |
| A0A192CND0 | 125-202 | None |
| A0A376SB09 | 5-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.