DPCstruct | MC3271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 5.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 62.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376VFE6 | 23-92 | HEGESGRRLWAECVALGIEARKAILARCKLFRPFIPPVVDGKLWQDYPTSVLASDRRFFSFEPGAKWHGF |
| A0A379TGT9 | 1-71 | MHEGVSGRNMWMDCVVNGVDTRKLILENCHHIRPFVPELIDGKPWQSYPTSEIACDLRFFHFVPGEHWQCV |
| A0A2X1QJI6 | 406-469 | None |
| A0A1W9F2W9 | 22-89 | None |
| A0A377KC06 | 33-113 | None |
| A0A4U9U313 | 83-153 | None |
| C0AX42 | 224-285 | None |
| A0A7U8X2I9 | 2-64 | None |
| A0A376RDA2 | 157-221 | None |
| A0A376LKV9 | 27-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.