DPCstruct | MC32707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 80 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182EDI2 | 4-70 | FSFPFEPYDIQLSLMQSITSCINEGKIGILESPTGTGKSMSIICATLSWLEKFEMQRKADLEKQLKA |
| A0A6G0ZJP6 | 1-80 | MSNIKSDVRPLFTYTIGGVKIEMPVRPYPSQVSMMDKVIRGCQKQQNCLLESPTGSGKTLALLCSALAWQRAEKGQKSQQ |
| A0A183H861 | 69-157 | None |
| U6KH94 | 57-161 | None |
| A0A834UJA5 | 2-77 | None |
| A0A6D2I1R0 | 14-100 | None |
| B9GX03 | 1-64 | None |
| A0A2P8XW57 | 3-74 | None |
| A0A1X7T7T2 | 4-67 | None |
| A0A183HR65 | 39-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.