DPCstruct | MC32705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 19.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 43.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H0V1 | 4-122 | IEFLKRKRIRPCLSVCQTVEQKCPYLLPGDRAPSYPTQYAGEPTFLCLDPNIPETGEQLRKSSDGPPECCYTYCGYPEDGLCTYCDE… |
| A0A2R7X2K9 | 1-136 | MEAYMAWLCSSVFKFEWVDSRNKLRELKPCRSFCHRVEQKCPFFLPLDKGPVHYAGEPTFLCLDPNIEETGEQLQKSSYGPSTCCYD… |
| A0A6J2YQF1 | 124-302 | None |
| A0A834IVF7 | 8-167 | None |
| A0A1W4X5J9 | 279-436 | None |
| A0A7R9HSH6 | 5-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.