DPCstruct | MC32701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 165 ± 28 aa |
| Standard deviation of domain lengths | 28.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8BG66 | 42-230 | LNIVTNLSELETDLINTWKEKTPSDFTWSGDNPYDLIYNFLWGCASKCPWCHEPCQKSDKAHGSERDCHNCIQHRPSGVAGIRCTNT… |
| A0A671R0D6 | 181-360 | QELPAIMSDISSRFNTNTFPEKLDYKFRPDELLIDHLCQCCWVQCPFCKAICTNTIENHDEDHSVPFHQVIGLSGIHYANTNNLSVH… |
| Q80SU7 | 2270-2415 | None |
| A0A1V9YU24 | 203-361 | None |
| A0A1V9YWH7 | 9-167 | None |
| A0A815V362 | 535-700 | None |
| A0A4W4FX57 | 788-938 | None |
| A0A7S3GBT8 | 193-405 | None |
| A0A498NTJ5 | 486-655 | None |
| A0A4W6FFN2 | 750-913 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.