DPCstruct | MC327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183UGV1 | 103-204 | WHLNRRGAVGETLLHVCFLSGLPDHMKLLAHRLVHHFPKIINDFYLCDEYYGETALHMGIVSEDAEIVRFLLKNGADVSQRTCGNFF… |
| A0A183GTP0 | 1-121 | LNDVTGVDMQESKFKEHKALWKLNKRGVDGENIIHLLLNREEQVCYEIARILLKHYPGMTNDIYMGDEMFGQSALHLAIVHDDYETV… |
| A0A1I7ZKR4 | 313-432 | None |
| A0A3M7QCD8 | 77-180 | None |
| A0A3P7JY70 | 1-115 | None |
| A0A6J8AEY6 | 123-214 | None |
| A0A0A9W835 | 3-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.