DPCstruct | MC32696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 246 ± 30 aa |
| Standard deviation of domain lengths | 30.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8B669 | 1-267 | MNSVITWVSSIKSVSNTESAAKIAKSVVHTLNPVFTREFQTTFEDSMTESLNLSPRETPQEKRKKTNQILTENTRSINKAIQNENED… |
| A0A6J8CVH6 | 12-267 | VSSIKSISNTESAAKIVKSVIHTLNPVFTREFQTTFEDSMTESLNLSPRETPQEKRKKTNQILTENTRSINKAIQNENEDVKKFLSS… |
| A0A7M5WIE4 | 1-181 | None |
| A0A6J8EUV6 | 1-252 | None |
| A0A6J8AB33 | 3-246 | None |
| A0A6J8A0G6 | 142-378 | None |
| A0A6J7ZYM8 | 41-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.