DPCstruct | MC32695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 250 ± 11 aa |
| Standard deviation of domain lengths | 11.44 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4RQY3 | 334-581 | TEGHQIKAKIPRQKVTVIAGTEGEGNFNRKATNACFSQPMGICVECNKKHFCYWCANRCCQISYDNKRNCRVLRHLGLLYKAFSIHL… |
| A0A8B6HFV2 | 556-814 | CTLCSSVSGYGETVIFCDSGINQVKEIIGPSVRVVAGTGQIGNDNGPCDKASFSQLFSLCTEMKNIFVCDAQTGCVEVITDMKGSVR… |
| A0A8B6BPV0 | 132-386 | None |
| A7RQ69 | 631-869 | None |
| A0A8B6CNZ4 | 166-429 | None |
| A0A8B6EPD7 | 308-554 | None |
| A0A2B4SWQ9 | 14-281 | None |
| A0A6J8D9A0 | 133-356 | None |
| A0A7D9DNN1 | 479-730 | None |
| A0A2B4SX29 | 345-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.