DPCstruct | MC32692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 168 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835GG88 | 6-170 | MKPIQPKVFKAIKDLDIEALKNFTQDEMRPIIPCLVRMALIAPLDTTRACGEAKKDVLTLLAGIDLVNFIVSLLSIEFNALESDLKK… |
| A0A6J8B3B9 | 8-163 | VKPEIFRAVRDVDISSLSDSKEFDLRPVLPCLVRMALCKPLDESSNWTKAKKEVLKILSGIEVVNGIVALLSIDFHALEQDVKKEQQ… |
| A0A672T533 | 2-183 | None |
| A0A7R9HIK1 | 2-175 | None |
| S9XGQ4 | 247-392 | None |
| A0A819PYN1 | 6-195 | None |
| A0A3P8T9F9 | 2-150 | None |
| E9HW39 | 1-165 | None |
| A0A7R8YWC8 | 7-182 | None |
| A0A6G0I956 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.