DPCstruct | MC32687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 57.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0PQ28 | 1-81 | MADGTGVSLTAFTQAFRSEGETYNGFYGKYQLEEYDLIYGGGKKQRTSYREALKSLNTNIKTALFPNGINEIPEEFKFKNQ |
| A0A449A4L3 | 737-802 | FRSEGYNYNGAFGKYNLPQYDLIYGGGKDQKTSYRQKLQEKYGDSIKTNLFPNGLKEINEEYKFNK |
| A0A5B7XVK5 | 131-195 | None |
| A0A2D1JL17 | 279-345 | None |
| A0A2D1JLT6 | 840-906 | None |
| E4QTS7 | 353-418 | None |
| A0A3B0PE06 | 47-110 | None |
| A0A7Z7D3I9 | 93-159 | None |
| A0A7Z7GF33 | 1-78 | None |
| A0A7U5CPD8 | 463-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.