DPCstruct | MC32681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 148 ± 38 aa |
| Standard deviation of domain lengths | 38.12 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 75.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18590 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4AIZ8 | 1-155 | MAVLARCGLQTCSVQRKIVDKRTNNNTNNTNNNTNNNNNSTNNNTNIMLRDEMVDGLDGPEGCYLVFESASGGRLMIFYSSGKIPKN… |
| F0YIC0 | 1-98 | MSTLGTKGCYLTFDAASQGTLFVHWSETPIEGAIAFFAPRKNVPGFKFKQNGGRSELIREMSGGTGERIKRYYSGWCQYVKLAKSFQ… |
| R1ENB1 | 16-114 | None |
| A0A7S3PHW9 | 381-565 | None |
| U6LLP7 | 62-248 | None |
| A0A7S2U8M2 | 30-199 | None |
| A0A7S1VEQ1 | 89-277 | None |
| U6KMQ8 | 1-145 | None |
| A0A2H6KEA2 | 110-328 | None |
| A0A7S4AJ29 | 28-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.