DPCstruct | MC3268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 3 aa |
| Standard deviation of domain lengths | 3.02 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 73.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377ATJ5 | 28-88 | EKELSKLQLTDSYQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGN |
| A0A379TCI3 | 1-56 | MEKARSQMHLDESYKLLEQITHYQDSPSCKEKHQCSLIDAKDTFSANYQQEPGVQG |
| A0A4P0Y3Q0 | 1-57 | None |
| A0A2X3CDR4 | 132-187 | None |
| A0A2X3L255 | 36-97 | None |
| A0A447MUE6 | 133-194 | None |
| A0A7H4N1T1 | 1-65 | None |
| A0A6D0EMZ1 | 3-63 | None |
| A0A379S575 | 1-62 | None |
| A0A7H4LVC6 | 27-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.