DPCstruct | MC32679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 153 ± 12 aa |
| Standard deviation of domain lengths | 12.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8IQN2 | 208-354 | RKLAPELSKYLEIAAEEVDYGWKTDVPQSDDWVEVDIQEIVRMQVARMSARIFVGEPACRDPEWLRVCLDFTIDAFTTAFLIRMFPP… |
| A0A0C3ADD4 | 23-168 | TKHLNALFPEVFEEIQLALGELKFPENDWKKVHVFPFVLQIVARASNRIFVGAPFCRNQEWIDFNLGGPAEVMLCSTILNLFPTWTL… |
| J0LJX3 | 117-256 | None |
| A0A194WDF1 | 29-193 | None |
| A0A395IXQ3 | 2-142 | None |
| A0A4Q4W8P0 | 47-205 | None |
| A0A6A6Y113 | 1-177 | None |
| A0A084AVL8 | 266-404 | None |
| A0A4Q4WSR3 | 35-178 | None |
| A0A1V8TNC7 | 146-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.