DPCstruct | MC32678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 12.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1GAW1 | 39-145 | INKRPTSADKAKSSKMPGSPHSPTNQAKARLTNEQKKKNHIESEKKRRDAIRAGFDRLADVVPGMQGQGRSEAVVLQHTVAYMKGMI… |
| A0A2G5H843 | 2-101 | NPSETPSSPINSAKSRLTEEQKKRNHIESEKKRREAIRNGFDRLSTIVPGMQGQARSEAIVLAATVDYMRSMINQKDKIYAAAMEKG… |
| A0A2U3EHH9 | 1074-1191 | None |
| A0A2D3UWT5 | 66-173 | None |
| A0A7C8P6D4 | 178-287 | None |
| A0A370TUQ8 | 585-700 | None |
| A0A1B7YDF1 | 47-168 | None |
| A0A1X2I543 | 281-407 | None |
| D4DGW5 | 205-326 | None |
| A0A0G4L9A8 | 564-686 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.