DPCstruct | MC32674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7FBK5 | 429-535 | MFDNITVDAQGKVALCEDVGNNPHLGKVWQYDPATDQLSQLAEHDASRFQTGGANFLTQDEESSGIVDVSHILGNAGENVYLVDTQA… |
| A0A258SQN7 | 2-113 | FDNLTVTSNGSLLIQEDPGNNQHLAATWHFDPVTDNAEKILEADPKYFQDKTSPFFITQDEENSGVIEITELVKEASWAKKGQQYFL… |
| A0A2U3PTQ3 | 542-646 | None |
| A0A1F8WU72 | 69-209 | None |
| A0A7W0UEN3 | 163-277 | None |
| A0A7C5G3C4 | 1-106 | None |
| A0A7V9KTR5 | 99-220 | None |
| A0A7V7MMV6 | 1-127 | None |
| A0A388P6Q3 | 403-518 | None |
| A0A1Q4BS82 | 355-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.