DPCstruct | MC32670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 286 ± 47 aa |
| Standard deviation of domain lengths | 47.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.70 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0672- PF20990 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P9GW06 | 251-507 | MKGVEFLRFYIATMAAALIFGWWFIRKGDSTREEAALPLPANPDPYELAYLRGGVQEVIRLAVFKLVQVRSLAAAAKNRRIGRVEGS… |
| A0A2T4U7X5 | 22-269 | KERNSALTAAPSVIKKNITPVEASLITGDSFTVRHVTATILDLVLKEHLSAERTADGRVMYMDNADRSKLKQYERSLVDYLFYRIGK… |
| A0A7X0U5B4 | 6-202 | None |
| A0A1G5F866 | 41-476 | None |
| A0A0M8WAU4 | 1-241 | None |
| A0A859FGJ4 | 3-269 | None |
| R6Z9Z0 | 22-402 | None |
| A0A7M3N1W0 | 664-957 | None |
| A0A6I5X3I5 | 2-275 | None |
| A0A6F8XR28 | 2-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.