DPCstruct | MC3267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 97.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 71.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3MAT1 | 203-296 | DKGTHVLWQVNGVAGDNLHKTGEGTLTVNGTGVNIGGLKVGDGTVILNQQADADGKVQAFSSVDIASGRPTVVLSDSQQVNPDNISW… |
| A0A379TBV6 | 1-79 | MNGVQGDNLHKIGEGVLKVNGTGINPGGLKVGDGTVILAQRPDEDGKVQAFSSVNIASGRPTVILTDSRQVNPDNISWG |
| A0A8B3KG60 | 61-154 | None |
| A0A855SI73 | 127-220 | None |
| A0A246W9C2 | 403-499 | None |
| A0A243V4M1 | 312-390 | None |
| I2SLT7 | 139-234 | None |
| A0A161KBA9 | 408-501 | None |
| A0A378F342 | 362-440 | None |
| A0A379SHH8 | 415-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.