DPCstruct | MC32669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 165 ± 21 aa |
| Standard deviation of domain lengths | 20.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 30.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4U5T5 | 1-199 | MSFRKFSFILVLVLIVSLLAVPFSALAAQPGTTGAKFLKNIPVSGELEDGRDFNGMLTVTEFGYDEEEGLLISGDLRGKATGDGPRP… |
| A0A2V8HK60 | 1-128 | MRTAAGAVVFSGLLRLSQFGLHRSRLVASGALSGIVTDEATGRTSNVIKAVWSLPATVSGNPESVFVRLGPMTVDLVGSVLTLLPSV… |
| A0A2V7Y455 | 1-162 | None |
| A0A4U1H4X8 | 10-167 | None |
| A0A1I4Z4F5 | 1-178 | None |
| A0A849HJJ5 | 3-158 | None |
| A0A285VX59 | 33-184 | None |
| A0A2V6VGE7 | 41-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.