DPCstruct | MC32664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 160 ± 25 aa |
| Standard deviation of domain lengths | 24.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0C8M4 | 193-338 | REKNLTPEYEWYNGTHKRYLKGDPINREAGTQINPPQGDIHDPEARITPYKIMKGVEPADPVNGHLIVPKLFGDGGYFETYDWVDAA… |
| A0A3M1R286 | 358-516 | TYDKKKGRFVWDMNVRPAYRWYNGKWTRKVVNVSDTYTEAGTEDDPVVLAAPTATADDPDAKLYPFKRFIGRQIADTTEKRMIVPHL… |
| A0A661ED15 | 293-495 | None |
| A0A3N5INE2 | 131-282 | None |
| A0A1F2XGH9 | 29-163 | None |
| A0A1V6GV79 | 93-255 | None |
| A0A1V4Y9U3 | 62-259 | None |
| A0A2N2AL36 | 700-879 | None |
| A0A2J6J417 | 453-600 | None |
| A0A7V5FQM5 | 14-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.