DPCstruct | MC32663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5E226 | 72-183 | EAAERWIYGYGDADGDGYVEYLPVSERGLQTQGWKDSGDSVSFKSGELARPPVAFVEVQGYLYQAYHSLVYIYERLGKRERIPIILE… |
| A0A2P8AV83 | 49-150 | EHALAALHWIDDYGDRDGDGYVEYGTRSPEGLGNQCWRDSPDGVCFSDGRIPVLPIATCEIQGYTYDAKLRLAELAELAELAELAEG… |
| A0A7W1CPH1 | 23-137 | None |
| A0A538DPL6 | 38-139 | None |
| A0A0F8M2C1 | 322-435 | None |
| A0A535CM50 | 386-481 | None |
| A0A7C7RNL9 | 68-168 | None |
| A0A2P7P3G9 | 1-113 | None |
| A0A535H917 | 64-144 | None |
| A0A2W4PQR4 | 666-784 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.