DPCstruct | MC32660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 172 ± 28 aa |
| Standard deviation of domain lengths | 27.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3ZQ68 | 28-183 | TLEDNMMRRAIKEHFKVEREMLTQRPRIKPLTLFFIDDIEGYRDGNNISGSLKTKFEEWTLAEAKALLKTETDEFYKRYLERTIADI… |
| A0A7X3DKY8 | 53-211 | GEERTALQRRVQIRETIRTHLRRERELYSRGVKVLSLFFIDEVSKYRLYDGDSGSGRSGEYAKMFEEEYVAVAEAFRREIDDPAYRA… |
| A0A1H2CWS8 | 265-420 | None |
| F9N4X7 | 1-178 | None |
| A0A7V3UBS6 | 117-273 | None |
| A0A3S4FAS8 | 43-205 | None |
| A0A855HRZ5 | 42-257 | None |
| A0A1F8UUC3 | 235-396 | None |
| T1UBU3 | 136-285 | None |
| A0A378N9I9 | 56-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.