DPCstruct | MC3266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 58.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6X489 | 140-206 | RDNIRFRHRVTRSIRDFMDGQGFVDIETPILTKSTPEGARDYLVPSRVHQGSFYALPQSPQIFKQLL |
| A0A7V7B383 | 141-209 | KTFALRHQTSKLIRNFLDEEQFLEIETPMLTKSTPEGARDYLVPSRVHHGEFYALPQSPQLFKQLLMVS |
| A0A453E1X0 | 10-80 | None |
| A0A6A5L0I2 | 148-208 | None |
| A0A5B8XDR5 | 153-213 | None |
| A0A420Z1C7 | 14-85 | None |
| A0A2M7TR25 | 150-210 | None |
| A0A6A5L7Q5 | 139-205 | None |
| A0A1V5JX99 | 29-95 | None |
| A0A0B3ARG6 | 145-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.