DPCstruct | MC32657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 163 ± 17 aa |
| Standard deviation of domain lengths | 17.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U8IFS2 | 1-207 | MNYILIYLSSILRSESMEKPFVKSLTAVAVGAGAIAICLFGYHINNQRQHQQRINYAESAITNQKDTLTSLSKEVDKLYSTKEKIFL… |
| A0A1E8GCD1 | 34-181 | RKQKIEYAQETAKKESANIRAIKTRVEKFYVNSSHDTLLNNVTKENVKKEYDKLGSIKISAQDFGVPENGLTSDVKELGKEKEETQK… |
| A0A7Z1Y9A1 | 468-630 | None |
| A0A1E5GGZ9 | 12-166 | None |
| A0A828TXL0 | 1-174 | None |
| A0A1E5KWW0 | 28-170 | None |
| A0A5P8JLM4 | 6-174 | None |
| A0A0D6DV67 | 1-140 | None |
| F0ENM3 | 239-396 | None |
| A0A1E5GPP7 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.