DPCstruct | MC32656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 165 ± 35 aa |
| Standard deviation of domain lengths | 34.52 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3V8L3 | 35-170 | RDYPDILLAFEAIEAGNIAKGVVHLANHEQINILQPTMYSDSDLVFALNGNQFAYVTNILPSSVTQPVELTLASQCKRIDNKRTITF… |
| A0A840MUF3 | 17-154 | QISPFIEEAFRLIPKIETASSVEIKARNQLKHLMAIAKHEQGVVLQPLIYEQADFKRALATMRSWPIRWISPKQQIVFTNHCETDDP… |
| A0A519GCC5 | 13-111 | None |
| A0A656H4W0 | 2-118 | None |
| A0A7W9X4S7 | 330-447 | None |
| A0A062BU25 | 19-220 | None |
| A0A5E7M4G8 | 311-449 | None |
| A0A829KFC0 | 81-270 | None |
| A0A2D0JUE4 | 352-523 | None |
| A0A378QS37 | 176-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.