DPCstruct | MC32655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 166 ± 26 aa |
| Standard deviation of domain lengths | 25.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7S7R7 | 25-211 | YLGDASEENGIIYSRRGGFIDMAHLRDQSDWTAYLYTQILEHKKKGSLSIILGREGGEKTLNVSIPTNLNNQDLINLAGKIAYDLSV… |
| D3V0G7 | 1-173 | MSSRSDVIKGRLVYTEKLGWVDTGHSKGNDARMLMAAINSGDDTKEPYFTIKYTQYMGLGLKYGTSKITRWKVRRGLSLHDKKRVAL… |
| A0A838F574 | 1-173 | None |
| A0A2E6SVG0 | 31-188 | None |
| A0A540VL34 | 86-205 | None |
| A0A133L9L8 | 10-174 | None |
| A0A6C0GDX8 | 32-214 | None |
| A0A1Y5FGD0 | 68-206 | None |
| A0A3N5UVQ6 | 179-371 | None |
| A0A2S3QU77 | 119-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.