DPCstruct | MC32652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 177 ± 24 aa |
| Standard deviation of domain lengths | 23.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376W1P5 | 139-360 | LIQALTPGIIQAGYSVEQQREVFEFVASSDYFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVI… |
| A0A2V3I9J2 | 35-221 | LNLVMAASKCMADQAHNIEYSTIVTAIARNGTEVGIRISGLGDQWFTDKAPIPEGLYFPGYSSKDANPDIGDSTITETVGLGGAAMA… |
| A0A6L8W9M2 | 382-558 | None |
| A0A7X7IWT6 | 255-474 | None |
| A0A376S668 | 57-216 | None |
| A0A0M0K0G8 | 876-1061 | None |
| A0A354U761 | 191-404 | None |
| A0A7T4YBD3 | 21-175 | None |
| A0A2V6TAC4 | 811-975 | None |
| A0A7Z7KRC0 | 2-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.