DPCstruct | MC32648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 154 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 47.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059AZ15 | 64-211 | IFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEAIEEEEDKREFVDSEDFILRMTIKELGLSDSVLESLANCLSRSPSEVK… |
| A0A103YH62 | 148-287 | KVEKLPRHVTSVFIDRNQRRIYDDHNGFSDEEEEEREFAGPEDNIIRMTVEEVGASDTVFDLLAKRLSREPCEVKARYEALVSRKNA… |
| A0A287VSQ9 | 145-293 | None |
| A0A151RYF1 | 52-223 | None |
| A0A6N2M1S4 | 1-146 | None |
| A0A6N2LYR2 | 180-326 | None |
| A0A0B2QC74 | 104-255 | None |
| A0A835N8M6 | 419-584 | None |
| A0A2U1LI94 | 167-314 | None |
| A0A2G2Y8S5 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.