DPCstruct | MC32646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 21.28 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P8B7H0 | 102-246 | QLYSDYMSSFKENMADLIEAGVIVDIEVGLGPAGELRYPSYPQSQGWVFPGIGEFQCYDKYLKKDFKEAAAKAGHPEWDLPEDAGEY… |
| A0A1D6P6U1 | 3-143 | SFRQRFRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAAAVASGHEEWGRGGPHDAGEYKQMPDD… |
| K8EBK2 | 214-372 | None |
| M7YWS0 | 65-172 | None |
| A0A1J6IR07 | 837-977 | None |
| A0A0D3DMD7 | 1-137 | None |
| A0A022QZX8 | 74-196 | None |
| A0A5D2TMC3 | 142-262 | None |
| A0A1U8EPT6 | 193-292 | None |
| A0A6A3AU23 | 105-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.