DPCstruct | MC32644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6P1I0 | 31-113 | VTRGQRGVFEHEAETDNPQSELKPGIDLLGSVDEIFYDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTIITGK |
| A0A287QBL6 | 62-164 | YVFCCSYSHNVASKGKFIAFVSAQAESDNPEAELKPGIDLLGPVDELFFDTYDRYEPANDPSSDNCFISTSYDATTHFESTVMDVLS… |
| A0A507FFD8 | 847-960 | None |
| A0A0L0S891 | 92-190 | None |
| A0A0M3I499 | 382-480 | None |
| A0A564XY23 | 70-180 | None |
| A0A6P3G0Z2 | 242-356 | None |
| A0A498LGE7 | 34-125 | None |
| A0A0K9QKC2 | 75-189 | None |
| A0A1D6FM08 | 238-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.