DPCstruct | MC32643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6P0B1 | 30-121 | AKRLAGIDKEVLVEVVRFTHKSGLRGCDGGWKDFLARNDRKFGASVSDPRKRSRDVLFAFLQTFPKDFQKIIGITSVSLLPVKEPGR… |
| A0A1Y1I1P1 | 4-126 | QDALEGFVPGDHDLLVKIVKETQRRGSAGSKGPWKSFLATLPRGDPSKPIQNDPARRDWQTLAAFCATLTTDEDVDLVRRMRGWFAW… |
| A0A2K3NYC9 | 39-164 | None |
| A0A6D2HG29 | 226-334 | None |
| A0A834ST66 | 2-101 | None |
| A0A6J5V8T8 | 2-98 | None |
| A0A6V7NTG9 | 131-244 | None |
| A0A3L6G545 | 78-172 | None |
| A0A1D6EVT3 | 26-101 | None |
| A0A2H9ZSM4 | 9-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.