DPCstruct | MC32641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 572 ± 81 aa |
| Standard deviation of domain lengths | 81.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.80 |
| Pfam Score | 84.72 |
| Assigned Pfam label(s) | PF08084- PF12134- CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4BI32 | 1-414 | MTIYPSPTGVLLAVDLAYNLYSGYGNWFPGCKPLMQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIW… |
| A0A1D6NUH7 | 617-1252 | GVMIGIDLAYNLHSAFGNWFPGSKPLLQQAMNKIMKSNPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGEIFSNQIIWFVDDTNVY… |
| A0A3Q0JBQ9 | 265-805 | None |
| V6TU29 | 401-918 | None |
| A0A0B1SWK9 | 1-614 | None |
| A0A0S7F0G9 | 284-859 | None |
| A0A7S4PR46 | 561-1084 | None |
| A0A5E4G278 | 2-587 | None |
| A0A7S1HJ85 | 311-946 | None |
| A0A7J6V9V7 | 455-984 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.