DPCstruct | MC3264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 100 ± 3 aa |
| Standard deviation of domain lengths | 2.86 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 96.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377E8G0 | 59-161 | FAVTDVRETLRTGAPKNAEDGPLPMACWSCKSPDVARLIQTDGEDGYFHGKWARGGPEIVNNLGCADCHNTASPEFAKGKPELTLSR… |
| A0A379T4G8 | 1-102 | MRETLRTGAPKTAEEGPLPMACWSCKSPDVARLIQQEGEDGYFHGKWARGGPEIVNDLGCADCHNTASDDFAQGKPALTLSRPYAER… |
| A0A090SGS3 | 24-120 | None |
| A0A376NYE6 | 96-198 | None |
| A0A0E2M4S6 | 121-217 | None |
| A0A378MW62 | 104-205 | None |
| A0A6G7LY73 | 34-134 | None |
| F9Q6Z1 | 103-197 | None |
| F4N7R0 | 67-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.