DPCstruct | MC32636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 54 ± 0 aa |
| Standard deviation of domain lengths | 0.00 |
| Length coefficient of variation | 0.00 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.99 |
| Mean intra-cluster sequence similarity (%) | 90.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5QQE0 | 1-54 | MGKTRGMGAGRKLKSHRRRQRWADKSYKKSNLGNEWKKPFAGSSHAKGIVLEKI |
| A0A1D6N7R1 | 1-54 | MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKM |
| A0A811MNE3 | 1-54 | None |
| A0A6A2XRM6 | 21-74 | None |
| A0A452ZAM5 | 23-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.