DPCstruct | MC32635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 659 ± 102 aa |
| Standard deviation of domain lengths | 102.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1WJZ6 | 240-772 | RQLLAEIDVDEAAGWDGVVYDLAVGAVGSVRPDVRHGDNMDLRRYVRIKRIPGGVPGDSQYIAGLVFTKSLAHRRMPRIYSSPRIML… |
| A0A1D6N5V4 | 100-737 | KVNLAERNKESRDDQLQKVMSEVMNGQFKILVSRFLAAEGLSLSDGGTDKNWLDIVASLSWDAALRVKPEANSGNAMDPGSYVKVKC… |
| A0A835RTB7 | 3-532 | None |
| A0A4P1RSI1 | 1-410 | None |
| A0A1D6E5I2 | 97-786 | None |
| A0A314YNI3 | 30-624 | None |
| A0A5J5BEI9 | 2-773 | None |
| A0A1D6LDJ5 | 14-764 | None |
| A0A6G0TQI3 | 454-1155 | None |
| O59722 | 471-1170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.