DPCstruct | MC32634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 45 ± 3 aa |
| Standard deviation of domain lengths | 2.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 71.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6MZX5 | 1-43 | MGLSDQDIVALFGGHTLGRCHKDRSGFEGAWTSNPLIFDNSSS |
| A0A7I4CA67 | 149-191 | MGLTDKDIVVLSGAHTLGRCHKDRSGFEGAWTPNPLRFDNSYF |
| A0A804RF59 | 140-183 | None |
| A0A813ASM5 | 47-95 | None |
| A0A139IFU9 | 43-85 | None |
| A0A2K3KWL2 | 57-99 | None |
| X6NKA7 | 95-145 | None |
| A0A6P9EU72 | 55-98 | None |
| A0A833Y5Y7 | 183-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.