DPCstruct | MC32632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 474 ± 77 aa |
| Standard deviation of domain lengths | 76.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.33 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | CL0179- CL0105- PF08326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1VR91 | 3-490 | ATLKQLVEVLRNPELPYSQWNAQFAALHSRMPQKLDSQFSQIVDRAKTRHADFPAKPLHKAFHRFLEENVAAGDADMLKTTLAPLTD… |
| A0A7R9QGQ8 | 1-330 | MNNYSSNITAILAAFPSQQIASVIDSYAATLQKRADRDVFFLNTQGIVQLVQRYRNGIRGRMRSCVQELVRNYIEVEQHFQSGHYDK… |
| A0A6I9XS55 | 646-1000 | None |
| A0A512UM59 | 12-544 | None |
| A0A818C258 | 27-581 | None |
| A0A6N2LWH0 | 382-904 | None |
| Q13085 | 799-1359 | None |
| A0A2T6ZQT5 | 102-531 | None |
| A0A2T6ZEI7 | 227-688 | None |
| A0A821VC91 | 349-896 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.