DPCstruct | MC32630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 5.23 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 37.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819JI22 | 157-244 | FQNVAKNNTLIYEEVFSTMPTNRARTFAQVNAYNGMPKMKDTDPIEAQQKLNGIQGFVVEYPLYFLDEENYLPSWTTPEGIAPLIIWT |
| A0A0J7KQ52 | 48-135 | WCARSKQNTKIYEEVFQCIPTDTVVNFSMLKQYQDKIPISLSDPLLAQEMAENIKGHLVDLPLHFLCNEDLKPAAGTVEGMMPTALWT |
| A0A5K3F5I2 | 65-152 | None |
| A0A1W0X0V4 | 92-180 | None |
| A0A822A470 | 76-151 | None |
| A0A0N4YIE7 | 37-130 | None |
| A0A820GB68 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.