DPCstruct | MC3263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 335 ± 24 aa |
| Standard deviation of domain lengths | 23.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379T434 | 1-337 | MKIPSNGQLLTLFLECACDALSQRKDILESTSFQGINRITVHCTIDKKYLVDSNSDITENFAPELFTQVSLINKDNYSANIKICINL… |
| A0A847TCP2 | 18-371 | PIYIDQDSQHHFSLVLEMYSAPIWSFSDQRSETGLGIWAYHVCEAVLFWLMKMEPVMHEWLDGIDLPVIDIEVHVDPAVADLDTIDA… |
| A0A1E5KZL7 | 468-805 | None |
| A0A261KN42 | 207-511 | None |
| A0A150NK24 | 1-369 | None |
| A0A2V9NH02 | 104-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.