DPCstruct | MC32628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 436 ± 52 aa |
| Standard deviation of domain lengths | 51.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | PF00347- CL0617- PF01822- PF09366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1VF77 | 10-415 | CGGARMPFRAGRIDAVEAGPAGVPEPDTPMDTTRSTFAKAGFSESEMIALVACGHTLGGVHSRNNPHITGLDPTPDTVTKFDSTFDD… |
| A0A6A6S6Z4 | 76-516 | ISGNVYTGVGGLDGSIQFELASSENNGNAFPGSVAAWAPFLSNRTSLADIVAAAVYTATRSCGGPIVPMRGGRIDATSAGPQGFVPQ… |
| A0A0G2HW19 | 4-438 | None |
| A0A4Q2DKT2 | 2-503 | None |
| W2RZ73 | 51-545 | None |
| T5ACE9 | 55-522 | None |
| S3D4X9 | 77-556 | None |
| A0A0J0XF12 | 51-523 | None |
| J5SD35 | 2-351 | None |
| V2X9F3 | 116-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.