DPCstruct | MC32621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 96 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9ZL45 | 16-99 | KTKSLNFGGMSNELWCPGGEVSFITRMIGESVNVRCKWFTTLVSKASHLPSIYRALDNVKPFDVRTIEMGQGQKQSRIVAWSFQ |
| A0A094EVE7 | 6-72 | GETAFVARMIAESVPLGQRVRWFTAQLGKLGSVATVVKELKEKGVKNWAVGELVQGRTKRWVVGWSW |
| A0A3M5UX41 | 2-68 | None |
| A0A482WLA8 | 53-163 | None |
| A0A1V9ZQJ8 | 199-292 | None |
| A0A7R8H9T0 | 133-232 | None |
| A0A2X0MHV8 | 1-96 | None |
| A0A0D6ESZ6 | 129-248 | None |
| A0A3P8KXK2 | 23-134 | None |
| A0A6D2IJ25 | 246-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.