DPCstruct | MC3262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379T2R0 | 1-82 | MLRSQFRNYTPAIRGVVNSQSATVSVIKNNRVIYQTNLPAGPFSLDGIMDNGGGDYLIQIKEADGSIRSYSQSADSLPVLQT |
| A0A810ZS72 | 167-242 | FPDAMQGFAPIVHGVAQTNALVKIIQNGVTIYQQNVSPGPFAINDILPTGSGGDLNVEVDEADGRIQRFTVPYSSV |
| A0A377ZAJ0 | 64-132 | None |
| A0A378F687 | 17-95 | None |
| A0A829EG19 | 18-103 | None |
| A0A484X7X6 | 164-238 | None |
| A0A379XRS8 | 203-277 | None |
| A0A377DAD1 | 1-67 | None |
| A0A6M8SYE6 | 33-108 | None |
| A0A2X2C3T8 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.