DPCstruct | MC32616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 112 ± 23 aa |
| Standard deviation of domain lengths | 22.74 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517TDY4 | 52-177 | IYVGKLPLIHFVVGKDPDTNRGKTARGIIAIGRWAVGVVAIGQCALGIFAIGQFAIGLLGGMGQFILGTVVVGQFAGGVLFSLGQFA… |
| A0A7C5FND8 | 7-115 | IKIFGWPLVSIALGPNHEENENKGIAKGFIAIGDISLGLISFGGVSFGLFSFGGVSLGAISAGGFAIGLFSMGAAAIGLAAVGGVAI… |
| A0A1Q3KXZ2 | 66-139 | None |
| A0A410P383 | 9-112 | None |
| A0A2V5WGA9 | 70-218 | None |
| A0A1G0RR11 | 20-153 | None |
| A0A7X6ZLQ5 | 34-154 | None |
| A0A3P8NYD5 | 40-114 | None |
| A0L422 | 5-87 | None |
| B9XI24 | 359-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.