DPCstruct | MC32613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 153 |
|---|---|
| Mean domain length (aa) | 172 ± 29 aa |
| Standard deviation of domain lengths | 29.15 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3XK10 | 3-143 | YLNKYGMGGLLAKLHASNKIYYIKEGATLTSSSFDPNTQTITWSSRTGVLTNNAFELSPTTVLNHEIDHAVQFDQNRQQQIKDANMQ… |
| S4Y4T2 | 77-238 | NVTVEGPPDFQNKVIRDLYFLSTTPSGQELFRRLDASGRPVKIVPESDPQNSFCTANDATAASDGTGTGSTVSYNPDARVNAYDRNG… |
| A0A4R1NFX4 | 753-963 | None |
| A0A3D9KIP4 | 9-155 | None |
| A0A7U0DLT7 | 4-165 | None |
| F8CCU5 | 43-280 | None |
| A0A838L9Y0 | 92-232 | None |
| A0A7Y3ZB11 | 14-189 | None |
| A0A377DCA5 | 1-132 | None |
| K2P1F1 | 122-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.