DPCstruct | MC32612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 215 ± 35 aa |
| Standard deviation of domain lengths | 34.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4XWA9 | 20-242 | TRNAFTTNALKASALTTDRVATGELTGNPLTTDAIAGSSDVLNALRDPLAREFLKYAVGCALPAGQSVEVSLGGETHVFEGDVGLSP… |
| I3IIG4 | 6-187 | GRELLKYLVECALPGGIELYGKTDGVEYTFEGVMGLAPDWEDEGLTPEQERWVSACMLARTNYFGKHVEISMRSPLKDAPVSLRTTP… |
| A0A7V9L870 | 6-270 | None |
| A0A017T460 | 78-324 | None |
| A0A085VWJ2 | 8-233 | None |
| A0A150PNW6 | 4-124 | None |
| A0A150P4L5 | 16-227 | None |
| A0A150P0R0 | 1-161 | None |
| A0A538QQW5 | 2-192 | None |
| A0A534P455 | 101-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.