DPCstruct | MC3261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 113 ± 21 aa |
| Standard deviation of domain lengths | 20.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9L7D5 | 3-104 | ERELIHERQIGSVLIQTYASPEEIPPEEVFEFQEDIVAVRSGKFVYFTTTVEVHFGPFVGTDHLGCCAYNNREDFTGLSYWRDMVRK… |
| A0A379T2N5 | 9-111 | WEDARRIKAALTTRGETLFYRQTRNFRLVVKENDMPCWLDDDDNLPVVLDAILEQRARYSSVEFFVISDKVDQILACGQMCDVLRIP… |
| A0A222QV47 | 143-225 | None |
| A0A0A0FNN4 | 1-88 | None |
| A0A2P1BPC1 | 44-142 | None |
| A0A7I6X6I0 | 28-147 | None |
| A0A828PYQ5 | 55-184 | None |
| A0A7U9BH96 | 94-223 | None |
| A0A4C5X7K4 | 4-119 | None |
| A0A377CX06 | 25-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.