DPCstruct | MC32605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 166 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11157 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7JH08 | 1-173 | MGIARGMALAVALMSATATSQLPEFSQQYRQRLGGAIDALERVKLSFSADANAFGMSVSEALEYMRDSDNAFVRKRAESMALSFARL… |
| A0A6L5QRQ8 | 12-188 | AYTAKIIVKKLLNYFKLITFSVLVLIGIQAPGFVSDYGKNLDARLAESKLSITPFQNTADKHFNGNIDKLINHYNNNGDQVLIEGGE… |
| A0A355GUP2 | 14-153 | None |
| A0A2N6B8P8 | 1-176 | None |
| A0A2T0W3F2 | 1-171 | None |
| A0A2E1LFU2 | 1-180 | None |
| A0A3B9IUB7 | 1-155 | None |
| K2JMI7 | 2-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.