DPCstruct | MC32602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 256 ± 34 aa |
| Standard deviation of domain lengths | 34.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L6WNU7 | 29-288 | DMFVSTAGAEIFADLSKKAFNRNPYQHDIYLYSGFYPYACLNLVDRTIATAHSKIAQKSYEDAYHLFEGLALFNLDDMAWPMCDDAE… |
| A0A364MVS9 | 45-279 | APVTEAPVIEARVTDGPASEVSTIQLKYLTIYSTSINSLMAKRQYPADELAIGLWVRLSAFAHWTHSEGLQPWSMMDDGERWQDTVA… |
| A0A395GHY3 | 2-228 | None |
| A0A1L7VVG5 | 106-390 | None |
| A0A179HWF4 | 204-483 | None |
| F0X9V7 | 148-369 | None |
| T5AIV5 | 66-337 | None |
| T5AK50 | 161-408 | None |
| A0A6A6GID0 | 66-308 | None |
| A0A6A6UDW9 | 55-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.